©2019 by ImmunoDiagnostics Limited.

Mouse Gremlim-2 (Grem2)

SKU: 42760

 

Origin:

Recombinant

Cat. No.:

42760

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other names:

Amino terminal brain natriuretic peptide precursor

Species:

Human

  • INTRODUCTION

    N-terminal pro-brain (or B-type) natriuretic peptide (NT-proBNP) is produced predominately by the cardiac ventricular myocytes. NT-proBNP is released in response to volume expansion and filling pressure and is involved in maintaining intravascular volume homeostasis. Elevated plasma levels of BNP and NT-proBNP have been observed at times of cardiac stress and damage.

     

  • DATA SHEET

    Click Here

  • DESCRIPTION

    Expressed in E.coli with total 112 AA. Mw: 12.6 KDa (calculated).

    N-terminal 6xHis-tag and TEV cleavage site, 36 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

     

  • AMINO ACID SEQUENCE

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

     

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolves completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized at 1 mg/mL in PBS.

  • APPLICATION

    Standard ELISA test, Western Blot.

  • SDS-PAGE Gel

    See image

  • ENDOTOXIN LEVEL

    <0.2 EU/ug

$200.00Price