©2019 by ImmunoDiagnostics Limited.

Human TEV Protease

SKU: 41870-10k

Type:

Recombinant

Cat. No.:

41870-10

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

RBP4

Species:

Human

  • INTRODUCTION

    Retinol binding protein 4(RBP4), originally known as a specific transport of retinol in blood, is also a novel inflammatory and insulin resistance marker. Serum levels of RBP4 increased in insulin resistant and diabetes. Studies both in human and animal suggested that serum levels of RBP4 plays a key role in the link between obesity, insulin resistant and diabetes. Animal experiments found that increased secretion of RBP4 might reduces insulin-dependent glucose uptake by muscle tissue by reducing the activity of PI(3)K (phosphoinositide 3-kinase), and increased hepatic glucose output by increasing the expression of the enzyme PEPCK. However, whether serum RBP4 could be a biomarker of type 2 diabetes risk still remain unclear.

     

  • DATA SHEET

  • DESCRIPTION

    Total 211 AA. Mw: 24.4 kDa (calculated). N-terminal His-tag and TEV cleavage site,

    28 extra AA (highlighted).

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAMGSERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQ

    DNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDH

    WIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC

    DGRSERNLL

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolve completely

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in 1 mg/mL in PBS.

  • APPLICATION

    ELISA and Western Blotting.

  • SDS-PAGE Gel

    See Image

  • ENDOTOXIN LEVEL

    <0.01EU per 1µg of protein by LAL method.

$400.00Price