R179Q (9Human Fibroblast Growth Factor 23)

SKU: 41295

Origin:

Recombinant

Cat. No.:

41295

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>90%

Other names:

FGF23

Species:

Human

  • INTRODUCTION

    FGF-23 is a bone-derived hormone that acts in the kidney to regulate phosphate homeostasis and vitamin D metabolism. The signaling receptor for FGF-23, a Klotho-FGFR1 (IIIc) complex, is an essential regulator of the renal sodium phosphate co-transporter and key vitamin D-metabolizing enzymes CYP27B1 and CYP24A1. Mature human FGF­23 contains an atypical (very low affinity) heparin binding site (aa 134­162), a proteolytic cleavage site (Arg179­Ser180), and multiple O­linked glycosylation sites with Thr178 being of particular importance. O­linked glycosylation at Thr178 blocks the cleavage of FGF­23, thereby preventing loss of FGF­23 activity. This recombinant human FGF23 bears mutation at 179th aa from arginine to glutamine preventing proteolytic cleavage.

  • DATA SHEET

  • DESCRIPTION

    Expressed in E.coli with total 271 AA. Mw: 30.4 KDa (calculated).

    N-terminal 6xHis-tag, EK and TEV cleavage site, 44 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQGAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized at 1 mg/mL in 50mM Tris, 300mM NaCl, 400mM arginine.

  • APPLICATION

    Standard ELISA test, Western Blot.

  • SDS-PAGE Gel

    See image

$200.00Price

©2019 by ImmunoDiagnostics Limited.