Human Interleukin 15 (hIL-15)
Type: | Recombinant | Cat. No.: | 41B060 |
Source: | E. coli | Size: | 0.1 mg |
Species: | Human | Purity: | >95% |
Description
Recombinant Human Interleukin 15 without Signal peptide and Propeptide(AA 49-162), total 115 amino acids (AA). N-terminal His-tag removed. Mw: 12.8 kDa (calculated). 1 extra AA left (In bold).
Introduction to the Molecule
Interleukin 15 (IL-15) is a widely expressed cytokine that is plays an important role in many immunological diseases. It promotes proliferation of activated T cells, natural killer cells, and B cells. Il-15 is structurally related to IL-2 and they share many functional characteristics.
Amino Acid Sequence
ANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Formulation
Lyophilized in 1 mg/mL in PBS.
Endotoxin Level
<0.2 EU/ug.
Applications
Cell culture, animal studies, ELISA and Western blotting.
Reconstitution
Add sterile deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.
Storage
Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. Avoid repeated freezing/thawing cycles
Biological Activity Test
The biological activity of Human IL-15 is determined by proliferation assay using Jurkat T cells.