©2019 by ImmunoDiagnostics Limited.

CENP-A (Centromere Protein A)

Human Centromere Protein A (CENPA)- 41610

 

Origin:

Recombinant

Cat. No.:

41610

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>95%

Other Names:

CENPA

Species:

Human

  • INTRODUCTION

    Centromere proteins are a group of proteins which form and/or mediate the function of centromeres, the central structures of chromosomes to which spindle fibers/microtubuli attach and pull the chromosomes apart in cell division. The centromere protein A (CENPA) is one of them. CENPA contains a histone H3 related histone fold domain and can be incorporated into centromeric chromatin due to its histone-like properties. Anti-CENPA autoantibodies are an important marker for diagnosis of Scleroderma / CREST syndrome.

  • DATA SHEET

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, CENP-A binds with IgG-type human auto-antibodies.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

  • APPLICATIONS

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • FORMULATION

    Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 150mM NaCl, 8M Urea, PH8.0).

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolve completely.

  • DESCRIPTION

    Expressed in insect Sf9 cells with total 164 AA. Mw: 19.0 KDa (calculated).

    N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeatedfreezing /thawing cycles.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • SDS-PAGE Gel

    Refer to picture 

$998.00Price
Quantity