Expressed in E.coli with total 141 AA. Mw: 16.7 KDa (calculated). N-terminal 6xHis-tag, EK and TEV cleavage site, 45 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

Beta 2 microglobulin is an 11 kDa protein associated with the outer membrane of many cells including lymphocytes. Beta 2-microglobulin is present in small amounts in serum, cerebrospinal fluid, and urine of normal people, and to a much greater degree in the urine and plasma of patients with tubular protein anemia, renal failure, or kidney transplants. Human Beta 2 microglobulin levels can rise either because its rate of synthesis has increased or because of impaired renal filtration. In addition, it has been reported that other increased serum levels are found in rheumatoid arthritis and autoimmune diseases.

Click Here

MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

Standard ELISA test, Western Blot.

Lyophilized at 1 mg/mL in 50mM phosphate, 10% glycerol, pH 8.0.

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing /thawing cycles.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.