©2019 by ImmunoDiagnostics Limited.

Human Beta 2 Microglobulin

Origin:

Recombinant

Cat. No.:

41680

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.Coli

Purity:

>90%

Other Names:

B2M

Species:

Human

  • INTRODUCTION

    Beta 2 microglobulin is an 11 kDa protein associated with the outer membrane of many cells including lymphocytes. Beta 2-microglobulin is present in small amounts in serum, cerebrospinal fluid, and urine of normal people, and to a much greater degree in the urine and plasma of patients with tubular protein anemia, renal failure, or kidney transplants. Human Beta 2 microglobulin levels can rise either because its rate of synthesis has increased or because of impaired renal filtration. In addition, it has been reported that other increased serum levels are found in rheumatoid arthritis and autoimmune diseases.

  • DATA SHEET

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, RNP68/70 binds with IgG-type human auto-antibodies.

  • AMINO ACID SEQUENCE

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

  • APPLICATIONS

    Standard ELISA test, Western Blot.

  • FORMULATION

    Lyophilized at 1 mg/mL in 50mM phosphate, 10% glycerol, pH 8.0.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

  • DESCRIPTION

    Expressed in E.coli with total 141 AA. Mw: 16.7 KDa (calculated).

    N-terminal 6xHis-tag, EK and TEV cleavage site, 45 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing /thawing cycles.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • SDS-PAGE Gel

    Refer to picture 

$998.00Price
Quantity