PCNA (Human Proliferating Cell Nuclear Antigen)
Origin:
Recombinant
Cat. No.:
41570
Tag:
N-terminal 6xHis
Size:
0.1 mg
Source:
Spodoptera frugiperda Sf9
Purity:
>90%
Other Names:
PCNA
Species:
Human
INTRODUCTION
PCNA is a co-factor of DNA polymerase delta, which forms a trimer ring around a DNA double-helix and is involved in in DNA synthesis, repair and processing, the regulation of cell cycle and even apoptosis. Autoantibody against PCNA occurs in patients with systemic lupus with a rare specificity (<10% of SLE patients).
IMMUNOLOGICAL FUNCTION
As an autoantigen, PCNA binds with IgG-type human auto-antibodies.
AMINO ACID SEQUENCE
MSYYHHHHHHDYDIPTTENLYFQGAFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
APPLICATIONS
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
FORMULATION
Liquid in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, Protease inhibitor, pH8.0).
DESCRIPTION
Expressed in insect Sf9 cells with a total of 285 AA.
Mw: 31.7 KDa (calculated).
N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
STORAGE
Store at –80°C. Avoid repeated freezing/thawing cycles.
QUALITY CONTROL TEST
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.

