• PCNA (Human Proliferating Cell Nuclear Antigen)

    Origin:

    Recombinant

    Cat. No.:

    41570

    Tag:

    N-terminal 6xHis

    Size:

    0.1 mg

    Source:

    Spodoptera frugiperda Sf9

    Purity:

    >90%

    Other Names:

    PCNA

    Species:

    Human

    • INTRODUCTION

      PCNA is a co-factor of DNA polymerase delta, which forms a trimer ring around a DNA double-helix and is involved in in DNA synthesis, repair and processing, the regulation of cell cycle and even apoptosis. Autoantibody against PCNA occurs in patients with systemic lupus with a rare specificity (<10% of SLE patients).

       

    • DATA SHEET

    • IMMUNOLOGICAL FUNCTION

      As an autoantigen, PCNA binds with IgG-type human auto-antibodies.

    • AMINO ACID SEQUENCE

      MSYYHHHHHHDYDIPTTENLYFQGAFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

    • APPLICATIONS

      Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

    • FORMULATION

      Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

    • RECONSTITUTION

      Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolve completely.

       

    • DESCRIPTION

      Expressed in insect Sf9 cells with total 285 AA. Mw: 31.7 KDa (calculated).

      N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

      Recombinant antigen for research use or manufacturing only.

    • STORAGE

      Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeatedfreezing /thawing cycles.

    • QUALITY CONTROL TEST

      BCA to determine quantity of the protein.

      SDS PAGE to determine purity of the protein.

    • SDS-PAGE Gel

      Refer to picture 

    $998.00Price
    Quantity

    ©2019 by ImmunoDiagnostics Limited.