EPO, Human, CHK
Species: | Human |
Expression System: | CHO |
MW: | 28-40 kDa (reducing) |
Accession: | P01588 |
Cat No.: | UA040004 |
Endotoxin: | ＜0.1 EU/μg |
Purity: | >95% as determined by SDS-PAGE |
INTRODUCTION
Erythropoietin (EPO) is a glycoprotein hormone that is principally known for its role in erythropoiesis, where it is responsible for stimulating proliferation and differentiation of erythroid progenitor cells. It is a secreted, glycosylated cytokine composed of four alpha helical bundles. Physiological levels of EPO in adult mammals are maintained primarily by the kidneys, whereas levels in fetal or neonatal mammals are maintained by the liver. EPO also can exert various non-hematopoietic activities, including vascularization and proliferation of smooth muscle, neural protection during hypoxia, and stimulation of certain B cells.
Amino Acid Sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Physical Appearance:
Lyophilized powder
Buffer:
PBS, pH 7.4
Reconstitution:
Reconstitute at less than 1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability and Storage
- 12 months from date of receipt, -20 to -70 °C as supplied.
- 6 months, -20 to -70 °C under sterile conditions after reconstitution.
- 1 week, 2 to 8 °C under sterile conditions after reconstitution.
Note: Please avoid repeated freeze-thaw cycles