top of page
FGF-1/FGF-Acidic, Human

FGF-1/FGF-Acidic, Human

SKU: UA040032

★ Download Datasheet PDF ★

★ Download MSDS ★

 

 Species:

Human

Expression System:

E.coli

MW:

17 kDa (reducing)

Accession:

P05230-1

Cat No.

UA040032

Endotoxin:

0.1 EU/μg

Purity:

>95% as determined by SDS-PAGE

  • INTRODUCTION

    Human fibroblast growth factor 1 (FGF-1), also known as acidic fibroblast growth factor (FGF-Acidic), is one of the best characterized members of the FGF superfamily. FGF-1 is a powerful mitogen that exhibits potent effects on numerous different types of cells. It plays a number of roles in several important physiological and pathological processes, such as embryonic development, morphogenesis, angiogenesis, wound healing and atheromasias, carcinogenesis, development, and invasion of cancer. FGF-1 is released extracellularly as a disulfide-linked homodimer and is stored in complex with extracellular heparan sulfate. The association of FGF-1 with heparan sulfate is a
    prerequisite for its subsequent interaction with FGF receptors. Ligation triggers receptor dimerization, transphosphorylation, and internalization of receptor/FGF complexes.

  • Amino Acid Sequence

    Phe16-Asp155
    MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

  • Physical Appearance:

    Lyophilized powder

  • Buffer:

    20mM PB, 150mM NaCl, 1mM DTT, pH7.4

  • Reconstitution:

    Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

  • Stability and Storage

    • 12 months from date of receipt, -20 to -70 °C as supplied.
    • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
    • 1 week, 2 to 8 °C under sterile conditions after reconstitution.

    Note: Please avoid repeated freeze-thaw cycles

$999.00Price
Quantity

The currency used on this website is United States Dollars (USD). All prices are displayed and transactions are processed in USD. For orders outside Hong Kong or if you would like to have other currencies available, please contact us for a quote.

bottom of page