top of page
FGF-basic (154aa), Human

FGF-basic (154aa), Human

SKU: UA040007

★ Download Datasheet PDF ★

★ Download MSDS ★

 

 Species:

Human

Expression System:

E.coli

MW:

17-18 kDa (reducing)

Accession:

P09038

Cat No.

UA040007

Endotoxin:

1 EU/μg

Purity:

>95% as determined by SDS-PAGE

  • INTRODUCTION

    Basic fibroblast growth factor (bFGF), also known as FGF2, is a member of the fibroblast growth factor (FGF) family. It is a highly specific chemotactic and mitogenic factor for many cell types, appears to be involved in remodeling damaged tissue, such as ulcer healing, vascular repair, traumatic brain injury (TBI). bFGF is a critical component of human embryonic stem cell culture medium. In addition, bFGF protein is a heparin-binding cationic protein involved in a variety of pathological conditions including angiogenesis and solid tumor growth. Thus, bFGF is regarded as a target for cancers chemo preventive and therapeutic strategies.

  • Amino Acid Sequence

    Ala135-Ser288
    AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

  • Physical Appearance:

    Lyophilized powder

  • Buffer:

    20 mM PB with 500 mM NaCl, pH 7.4

  • Reconstitution:

    Reconstitute at less than 0.2 mg/ml according to the size in ultrapure water after rapid centrifugation.

  • Stability and Storage

    • 12 months from date of receipt, -20 to -70 °C as supplied.
    • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
    • 1 week, 2 to 8 °C under sterile conditions after reconstitution.

    Note: Please avoid repeated freeze-thaw cycles

$999.00Price
Quantity

The currency used on this website is United States Dollars (USD). All prices are displayed and transactions are processed in USD. For orders outside Hong Kong or if you would like to have other currencies available, please contact us for a quote.

bottom of page