Human Growth Differentiation Factor 15 (GDF-15)

Human Growth Differentiation Factor 15 (GDF-15)

SKU: 41980

★ Download Datasheet PDF ★

 

 

Origin:

Recombinant

Cat. No.:

41980

Tag:

N-terminal 6xHis

Size:

20 g

Source:

E.coli

Purity:

>90%

Other names:

MIC-1, PDF

Species:

Human

  • INTRODUCTION

    GDF-15 plays an important role in tumorigenesis and metastasis. It has been observed that in many types of cancers, such as colorectal, breast, and prostate, the expression of GDF-15 is dramatically increased.

    Additionally, in cancer patients, serum levels of GDF-15 are elevated, which are of value in disease diagnosis and stratification. GDF-15 is strongly induced by the tumor suppressor gene p53 and other anti- tumorigenic agents, such as the non-steroidal anti-inflammatory drugs and peroxisome proliferators activated receptor γ. These findings suggest that GDF-15 may be a downstream target of those signaling pathways that regulate cell cycle arrest and apoptosis. Through the modulation of neuronal pathways important in the regulation of appetite and energy homeostasis, GDF-15 mediates cancer-induced anorexia and weight loss.

  • STRUCTURE AND ACTIVITY

    Disulfide-linked homodimer​.

    10nM of recombinant hGDF15 is able to activate AKT and ERK phosphorylation in HEK293 cells co-transfected with the GDF15 receptor complex GFRAL and RET51.​

  • AMINO ACID SEQUENCE

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQGARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTG VSLQTYDDLLAKDCHCI

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    1. Briefly centrifuge before opening the vial. 
    2. Add 200µl sterile deionized water to prepare a stock solution of approximately 0.1 mg/mL and let the lyophilized pellet dissolve completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in a solution containing 50mM Na2HPO4 and 500mM NaCl, pH 8.0.

  • APPLICATION

    ELISA and Western Blotting.

  • ENDOTOXIN LEVEL

    <0.01EU per 1µg of protein by LAL method.

$200.00Price

For bulk order (QTY: 5 or more), please contact us for quote

Featured Products