hGDF-15 (Human Growth Differentiation Factor 15)
  • hGDF-15 (Human Growth Differentiation Factor 15)

    SKU: 41980

    ★ Download Datasheet PDF ★

     

     

    Origin:

    Recombinant

    Cat. No.:

    41980

    Tag:

    N-terminal 6xHis

    Size:

    20 g

    Source:

    E.coli

    Purity:

    >90%

    Other names:

    MIC-1, PDF

    Species:

    Human

    • INTRODUCTION

      GDF-15 plays an important role in tumorigenesis and metastasis. It has been observed that in many types of cancers, such as colorectal, breast, and prostate, the expression of GDF-15 is dramatically increased.

      Additionally, in cancer patients, serum levels of GDF-15 are elevated, which are of value in disease diagnosis and stratification. GDF-15 is strongly induced by the tumor suppressor gene p53 and other anti- tumorigenic agents, such as the non-steroidal anti-inflammatory drugs and peroxisome proliferators activated receptor γ. These findings suggest that GDF-15 may be a downstream target of those signaling pathways that regulate cell cycle arrest and apoptosis. Through the modulation of neuronal pathways important in the regulation of appetite and energy homeostasis, GDF-15 mediates cancer-induced anorexia and weight loss.

    • DATA SHEET

    • STRUCTURE AND ACTIVITY

      Disulfide-linked homodimer​.

      10nM of recombinant hGDF15 is able to activate AKT and ERK phosphorylation in HEK293 cells co-transfected with the GDF15 receptor complex GFRAL and RET51.​

    • AMINO ACID SEQUENCE

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQGARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTG VSLQTYDDLLAKDCHCI

    • STORAGE

      Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

    • RECONSTITUTION

      1. Briefly centrifuge before opening the vial. 
      2. Add 200µl sterile deionized water to prepare a stock solution of approximately 0.1 mg/mL and let the lyophilized pellet dissolve completely.

    • QUALITY CONTROL TEST

      BCA to determine quantity of the protein.

      SDS PAGE to determine purity of the protein.

    • FORMULATION

      Lyophilized in a solution containing 50mM Na2HPO4 and 500mM NaCl, pH 8.0.

    • APPLICATION

      ELISA and Western Blotting.

    • SDS-PAGE Gel

      Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

    • ENDOTOXIN LEVEL

      <0.01EU per 1µg of protein by LAL method.

    $200.00Price

    ©2019 by ImmunoDiagnostics Limited.