Histone H3

Histone H3

★ Download Datasheet PDF ★

 

 

Origin:

Recombinant

Cat. No.:

41830

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>90%

Other Names:

H3

Species:

Human

  • INTRODUCTION

    Histones are proteins that package DNA into nucleosomes and are responsible for maintaining the shape and structure of a nucleosome. 

    There are five families of histones known to date, H1/H5, H2A, H2B, H3, and H4. 

    H3, along with H2A, H2B and H4, is considered as a core histone. 

    Anti-histone autoantibodies are found in 50%-70% of patients with systemic lupus erythematosus (SLE) and in more than 95% of patients with drug-induced lupus erythematosus.

  • DATA SHEET

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, H3 binds with IgG-type human auto-antibodies.

  • AMINO ACID SEQUENCE

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQGAARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

  • APPLICATIONS

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • FORMULATION

    Liquid in storage buffer (137mM NaCl, 2.7mM KCl, 100mM Na2HPO4, 1.5mM KH2PO4, Protease inhibitor, pH 7.4).

  • DESCRIPTION

    Expressed in E.coli cells with a total of 179 AA.

    Mw: 20.33 KDa (calculated).

    N-terminal 6xHis-tag, Xpress Epitope, EK recognition site, and TEV cleavage site, 44 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • STORAGE

    Store at –80°C. Avoid repeated freezing/thawing cycles.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • SDS-PAGE Gel

    Refer to picture 

Quantity

©2019 by ImmunoDiagnostics Limited.