©2019 by ImmunoDiagnostics Limited.

Human FGF-19

SKU: 41284

Origin:

Recombinant

Cat. No.:

41284

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>90%

Other Names:

FGF-19

Species:

Human

  • INTRODUCTION

    Fibroblast growth factor 19 (FGF-19) is a member of a subfamily of FGFs that includes FGF-21 and FGF-23, each member functions as an important regular of nutrient metabolism. The primary source of endocrine FGF-19 is the ileum, bile acids release into the intestine after a meal to induce expression of FGF-19. Circulating FGF-19 plays an important role in maintaining proper bile acid homeostasis. Several pharmacologic studies in hyperglycaemic, obese animal models have shown that FGF-19 can improve metabolic rate and lower serum glucose and hepatic triglyceride and cholesterol levels. Like insulin, FGF-19 functions as postprandial hormone to govern hepatic protein synthesis, glycogen synthesis and gluconeogenesis, but does not stimulate lipogenesis.  

  • DATA SHEET

  • DESCRIPTION

    Expressed in E.coli cells with total 217 AA. Mw: 24.5 kDa (calculated). 

    C-terminal 6xHis-tag, 25 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGALAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

  • APPLICATION

    ELISA and Western Blotting.

  • SDS-PAGE Gel

    See image

  • ENDOTOXIN LEVEL

    <0.2 EU per 1 μg of the protein by the LAL method.

     

$260.00Price