Fibroblast growth factor 19 (FGF-19) is a member of a subfamily of FGFs that includes FGF-21 and FGF- 23, each member functions as an important regular of nutrient metabolism. The primary source of endocrine FGF-19 is the ileum, bile acids release into the intestine after a meal to induce expression of FGF-19. Circulating FGF-19 plays an important role in maintaining proper bile acid homeostasis. Several pharmacologic studies in hyperglycaemic, obese animal models have shown that FGF-19 can improve metabolic rate and lower serum glucose and hepatic triglyceride and cholesterol levels. Like  insulin, FGF-19 functions as postprandial hormone to govern hepatic protein synthesis, glycogen synthesis and gluconeogenesis, but does not stimulate lipogenesis.

Expressed in E.coli cells with total 194 AA. Mw: 21.6 KDa (calculated).

No tag, but with 2 extra AA at N-terminal (highlighted). Recombinant protein for research use or manufacturing only.

Recombinant antigen for research use or manufacturing only.

GALAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

ELISA and Western Blotting.

<0.2 EU per 1 μg of the protein by the LAL method.