top of page

IL6, Human

SKU: UA040052

★ Download Datasheet PDF ★

★ Download MSDS ★

 Species:

Human

Expression System:

E.coli

MW:

21 kDa (reducing)

Accession:

P05231

Cat No.

UA040052

Endotoxin:

1 EU/μg

Purity:

>95% as determined by SDS-PAGE

  • INTRODUCTION

    Interleukin-6 (IL-6) is a member of the pro-inflammatory cytokine family, induces the expression of a variety of proteins responsible for acute inflammation, and plays an important role in the proliferation and differentiation of cells in humans. Interleukin 6 was originally identified as a T cell derived lymphokine that induces final maturation of B cells into antibody-producing cells. Recombinant human IL-6 acts on B cells activated with Staphylococcus aureus Cowan I or pokeweed mitogen (PWM) to induce immunoglobulin M (IgM), IgG and IgA production, but not on resting B cells. Furthermore, IL-6 was shown to augment the primary and secondary anti-SRBC (sheep red blood cell) antibody production in mice in vivo.

  • Amino Acid Sequence

    VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

  • Physical Appearance:

    Lyophilized powder

  • Buffer:

    20mM Tris, 100mM NaCl, pH8.0

  • Reconstitution:

    Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

  • Stability and Storage

    • 12 months from date of receipt, -20 to -70 °C as supplied.
    • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
    • 1 week, 2 to 8 °C under sterile conditions after reconstitution.

    Note: Please avoid repeated freeze-thaw cycles

$999.00Price
Quantity

The currency used on this website is United States Dollars (USD). All prices are displayed and transactions are processed in USD. For orders outside Hong Kong or if you would like to have other currencies available, please contact us for a quote.

bottom of page