Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), is a hematopoietic growth factor. It can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of several diseases, including breast and endometrial cancers. The biological activity of human M-CSF is only active in the disulfide-linked dimeric form, which is bonded at Cys63.

Glu33-Ser190
MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLV
QDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLE
KVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Lyophilized powder

50mM Tris, 300mM NaCl, pH8.0

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

• 12 months from date of receipt, -20 to -70 °C as supplied.
• 6 months, -20 to -70 °C under sterile conditions after reconstitution.
• 1 week, 2 to 8 °C under sterile conditions after reconstitution.

Note: Please avoid repeated freeze-thaw cycles