M-CSF, Human
Species: | Human |
Expression System: | E.coli |
MW: | 19 kDa (reducing) |
Accession: | P09603-3 |
Cat No. | UA040042 |
Endotoxin: | <1 EU/μg |
Purity: | >95% as determined by SDS-PAGE |
INTRODUCTION
Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), is a hematopoietic growth factor. It can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of several diseases, including breast and endometrial cancers. The biological activity of human M-CSF is only active in the disulfide-linked dimeric form, which is bonded at Cys63.
Amino Acid Sequence
Glu33-Ser190
MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLV
QDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLE
KVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGSPhysical Appearance:
Lyophilized powder
Buffer:
50mM Tris, 300mM NaCl, pH8.0
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability and Storage
- 12 months from date of receipt, -20 to -70 °C as supplied.
- 6 months, -20 to -70 °C under sterile conditions after reconstitution.
- 1 week, 2 to 8 °C under sterile conditions after reconstitution.
Note: Please avoid repeated freeze-thaw cycles