top of page

Mouse Fibroblast Growth Factor-4 (mFGF4)

SKU: 42B070

★ Download Datasheet PDF ★

Type:

Recombinant

Cat. No.:

42B070

Source:

E. coli

Size:

0.1 mg

Species:

Mouse

Purity:

>95%

 

 

  • Description

    Recombinant Mouse FGF4 without Signal peptide (AA 30-202), total 196 amino acids (AA). N-terminal 6xHis-tag and TEV cleavage site.    Mw: 21.9 kDa (calculated). 23 extra AA left (In bold).

  • Introduction to the Molecule

    FGF-4, also known as FGF-K or K-FGF (Kaposi’s sarcoma-associated FGF), is a heparin-binding member of the FGF family. It plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Mature mouse FGF-4 shares 87% aa identity with human FGF-4. FGF-4 is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.

  • Amino Acid Sequence

    MSYYHHHHHHDYDIPTTENLYFQAPNGTRHAELGHGWDGLVARSLARLPVAAQPPQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL

  • Formulation

    Lyophilized in 1 mg/mL in PBS.

  • Endotoxin Level

    <0.2 EU/ug.

  • Applications

    Cell culture, animal studies, ELISA and Western blotting.

  • Reconstitution

    Add sterile deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

  • Storage

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles

$430.00Price
Quantity

The currency used on this website is United States Dollars (USD). All prices are displayed and transactions are processed in USD. For orders outside Hong Kong or if you would like to have other currencies available, please contact us for a quote.

bottom of page