IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. The N-terminal portion of full length IL-33 contains a predicted bipartite nuclear localization sequence and a homeodomain-like helix-turn-helix DNA binding domain. The C-terminal fragment, corresponding to mature IL-33, binds and triggers signaling through mast cell IL-1 R4/ST2L, a longtime orphan receptor involved in the augmentation of Th2 cell responses. A ternary signaling complex is formed by the subsequent association of IL-33 and ST2L with IL- 1R AcP. Stimulation of Th2 polarized lymphocytes with mature IL-33 in vitro induces IL-5 and IL-13 secretion. In vivo administration of mature IL-33 promotes increased production of IL-5, IL-13, IgE, and IgA, as well as splenomegaly and inflammatory infiltration of mucosal tissues.

Expressed in E.coli with total 160 AA. Mw: 17.7 KDa (calculated).

No tag, but with 2 extra AA at N-terminal (highlighted).

Recombinant antigen for research use or manufacturing only.

GASIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolves completely.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 7.0.

ELISA and Western Blotting.

<0.2 EU per 1 μg of the protein by the LAL method.

1. Cheong LY, Wang B, Wang Q, Jin L, Kwok KHM, Wu X, Shu L, Lin H, Chung SK, Cheng KKY, Hoo RLC, Xu A. Fibroblastic reticular cells in lymph node potentiate white adipose tissue beiging through neuro-immune crosstalk in male mice. Nat Commun. 2023 Mar 3;14(1):1213.