mIL-33 (Mouse Interleukin-33)
  • mIL-33 (Mouse Interleukin-33)

    SKU: 41750

    ★ Download Datasheet PDF ★

     

     

    Origin:

    Recombinant

    Cat. No.:

    41750

    Tag:

    No tag

    Size:

    0.1 mg

    Source:

    E.coli

    Purity:

    >90%

    Other names:

    IL-33, IL-1F11

    Species:

    Mouse

    • INTRODUCTION

      IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. The N-terminal portion of full length IL-33 contains a predicted bipartite nuclear localization sequence and a homeodomain-like helix-turn-helix DNA binding domain. The C-terminal fragment, corresponding to mature IL-33, binds and triggers signaling through mast cell IL-1 R4/ST2L, a longtime orphan receptor involved in the augmentation of Th2 cell responses. A ternary signaling complex is formed by the subsequent association of IL-33 and ST2L with IL- 1R AcP. Stimulation of Th2 polarized lymphocytes with mature IL-33 in vitro induces IL-5 and IL-13 secretion. In vivo administration of mature IL-33 promotes increased production of IL-5, IL-13, IgE, and IgA, as well as splenomegaly and inflammatory infiltration of mucosal tissues.

    • DATA SHEET

    • DESCRIPTION

      Expressed in E.coli with total 160 AA. Mw: 17.7 KDa (calculated).

      No tag, but with 2 extra AA at N-terminal (highlighted).

      Recombinant antigen for research use or manufacturing only.

    • AMINO ACID SEQUENCE

      GASIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

    • STORAGE

      Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

    • RECONSTITUTION

      Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolves completely.

    • QUALITY CONTROL TEST

      BCA to determine quantity of the protein.

      SDS PAGE to determine purity of the protein.

    • FORMULATION

      Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 7.0.

    • APPLICATION

      ELISA and Western Blotting.

    • SDS-PAGE Gel

      See image

    • ENDOTOXIN LEVEL

      <0.2 EU per 1 μg of the protein by the LAL method.

    • BIOACTIVITY TEST

      See Image 2

    ©2019 by ImmunoDiagnostics Limited.