mIL-13 (Mouse Interleukin-13)

mIL-13 (Mouse Interleukin-13)

SKU: 42450

★ Download Datasheet PDF ★

 

 

Origin:

Recombinant

Cat. No.:

42450

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other names:

IL-13

Species:

Mouse

  • INTRODUCTION

    Interleukin-13 (IL-13) is a monomeric 17 kDa immunoregulatory cytokine that plays a key role in the pathogenesis of allergy, cancer, and tissue fibrosis. It is secreted by several helper T cell subsets, NK cells, mast cells, eosinophils, basophils, and visceral smooth muscle cells. IL-13 suppresses the production of proinflammatory cytokines and other cytotoxic substances by macrophages, fibroblasts, and endothelial cells. On B cells, it promotes cellular activation, immunoglobulin class switching to IgE, and the up‑regulation of CD23/Fc epsilon RII.

  • DATA SHEET

  • DESCRIPTION

    Expressed in E.coli with total 135 AA. Mw: 15.2 KDa (calculated).

    N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolves completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 7.0.

  • APPLICATION

    ELISA and Western Blotting.

  • SDS-PAGE Gel

    See image

  • ENDOTOXIN LEVEL

    <0.2 EU per 1 μg of the protein by the LAL method.

     

©2019 by ImmunoDiagnostics Limited.