Mouse Recombinant Leptin protein
Origin:
Recombinant
Cat. No.:
42B039
Tag:
Tagless
Size:
0.1 mg
Source:
E.coli
Purity:
>99%
Bioactive:
Yes
Species:
Mouse
INTRODUCTION
Encoded by the ob (obese) gene, Leptin is an adipose-derived cytokine that suppresses appetite and increases thermogenesis. Mouse Leptin shares approximately 84% sequence identity with the human protein. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese, diabetic and to have reduced activity, metabolism and body temperature.
DESCRIPTION
Recombinant Mouse Leptin without Signal peptide (AA22-167), total 147 amino acids (AA). N-terminal His-tag removed. Mw: 16.1 kDa (calculated). 1 extra AA left (In bold).
AMINO ACID SEQUENCE
AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDI LQQLDVSPEC
STORAGE
Store at –20°C. Avoid repeated freezing/thawing cycles.
ENDOTOXIN LEVEL
<0.2 EU/ug.
FORMULATION
Lyophilized in 1 mg/mL in PBS.
APPLICATION
Cell culture, animal studies, ELISA and Western blotting.
RECONSTITUTION
Add sterile deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

