Recombinant Adiponectin with Flag Tag (Human)

SKU: 41013

Type:

Recombinant

Cat. No.:

41013

Tag:

Flag

Size:

0.1 mg

Source:

HEK293

Purity:

>98%

Other names:

Acrp30, GBP28, AdipoQ

Species:

Human

  • INTRODUCTION

    Adiponectin is an adipokine exclusively expressed in adipose tissues with potent anti-diabetic, anti-atherogenic and anti-inflammatory functions.
    In humans, decreased serum adiponectin levels are associated with increased body mass index (BMI), decreased insulin sensitivity, less favourable plasma lipid profiles, increased inflammation and increased risk for the development of type 2 diabetes, hypertension and coronary heart diseases.

     

  • DATA SHEET

  • DESCRIPTION

    Total 234 AA. Mw: 25.5kDa (calculated). C-terminal flag-tag, 8 extra AA(highlighted).

  • AMINO ACID SEQUENCE

    ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNDYKDDDDK

  • ENDOTOXIN LEVEL

    <0.2 EU/ug.

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

    Avoid repeated freezing /thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and letthe lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in 1 mg/mL in PBS.

  • APPLICATION

    Cell culture, ELISA and Western blotting.

  • SDS-PAGE Gel

    See pictures.

$370.00Price

©2019 by ImmunoDiagnostics Limited.