hFABP5 (Human Fatty Acid Binding Protein 5)

hFABP5 (Human Fatty Acid Binding Protein 5)

SKU: 41040

★ Download Datasheet PDF ★

 

 

Type:

Recombinant

Cat. No.:

41040

Tag:

His

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other names:

E-FABP; PA-FABP

Species:

Human

  • INTRODUCTION

    The fatty-acid-binding proteins (FABPs) are a family of carrier proteins for fatty acids and other lipophilic substances such as eicosanoids and retinoids. These proteins are thought to facilitate the transfer of fatty acids between extra- and intracellular membranes. The fatty acid binding protein 4 (FABP-4) and fatty acid binding protein 5(FABP5) are closely related and both are expressed in adipocytes. Mice with targeted disruption of FABP-4 accompany FABP-5 almost completely protect against diet-induced obesity, insulin resistance, dyslipidemia, type 2 diabetes, and fatty liver disease. While mice over expressing FABP5 in adipose have reduced insulin sensitivity.

  • DATA SHEET

  • DESCRIPTION

    Total 162 AA. Mw: 18.4 kDa (calculated).

    N-terminal His-tag and TEV cleavage site, 28 extra AA (highlighted).

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAMGSATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoidrepeated freezing /thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and letthe lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Filtered (0.22 μm) and lyophilized in 1 mg/mL in PBS.

  • APPLICATION

    Western blotting

  • SDS-PAGE Gel

    See pictures.

$200.00Price

©2019 by ImmunoDiagnostics Limited.