Mouse Fibroblast Growth Factor 21 (FGF-21), Tagless

Mouse Fibroblast Growth Factor 21 (FGF-21), Tagless

SKU: 42189

★ Download Datasheet PDF ★

 

 

Type:

Recombinant

Cat. No.:

42189

Tag:

No Tag

Size:

100 µg

Source:

E.Coli

Purity:

>95%

Other names:

FGF21

Species:

Mouse

  • INTRODUCTION

    FGF-21, a polypeptide with 210 amino acid residues produced mostly from the liver tissue. Mouse FGF- 21 shares 75% identity as human FGF-21. Recent animal studies indicate it possesses potent beneficial effects on glucose and lipid metabolism and insulin sensitivity. Increasing data shows FGF-21 can significantly stimulate glucose uptake in mature adipocytes. And the lowered LDL-cholesterol and increased HDL-cholesterol can also be observed. FGF-21 exerts its bioactivity through interaction with membrane bound FGF receptors (FGFRs) which requires β-Klotho as a co-factor to bind and activate FGFR signaling. The activation of FGF-21 can induce the stimulation of diverse downstream pathways medicated by MAPK,FRS-2, SHP-2, PI3K, raf, stat and other signaling molecules. In sum, FGF-21 induces a variety of significant beneficial metabolic changes without apparent adverse effects which makes this factor a hot candidate to treat some metabolic diseases.

  • DESCRIPTION

    Total 184 AA Mw: 20kDa (calculated).

    N-terminal His- tag removed, 2 extra AA left (highlighted).

  • AMINO ACID SEQUENCE

    GAAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.Avoid repeated freezing /thawing cycles.

  • RECONSTITUTION

    Add sterile deionized water to prepare a working stock solution of approximately 1 mg/mLand let the lyophilized pellet dissolve completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in 1 mg/mL in PBS.

  • APPLICATION

    Cell culture, animal studies, ELISA and Western blotting.

  • PUBLICATIONS CITING OUR PRODUCT:

    • Lin Z, Tian H, et al. Adiponectin mediates the metabolic effects of FGF21 on glucose homeostasis and insulin sensitivity in mice. Cell Metab. 2013 May 7;17(5):779-89
    • So WY, Cheng Q, et al. High Glucose Represses β-Klotho Expression and Impairs Fibroblast Growth Factor 21 Action in Mouse Pancreatic Islets: Involvement of Peroxisome Proliferator-Activated Receptor γ Signaling. Diabetes. 2013 Nov;62(11):3751-9.
    • Li H, Gao Z, et al. Sodium butyrate stimulates expression of fibroblast growth factor 21 in liver by inhibition of histone deacetylase 3. Diabetes. 2012 Apr;61(4):797-806.
    • Ge X, Chen C, et al. Fibroblast growth factor 21 induces glucose transporter-1 expression through activation of the serum response factor/Ets-like protein-1 in adipocytes. J Biol Chem. 2011 Oct 7;286(40):34533-41.
  • ENDOTOXIN LEVEL

    <0.2 EU/ug.

$360.00Price

For bulk order (QTY: 5 or more), please contact us for quote

Featured Products