mFGF21, Tagless (Mouse Fibroblast Growth Factor 21 with No Tag)
  • mFGF21, Tagless (Mouse Fibroblast Growth Factor 21 with No Tag)

    SKU: 42189

    ★ Download Datasheet PDF ★

     

     

    Type:

    Recombinant

    Cat. No.:

    42189

    Tag:

    No Tag

    Size:

    100 µg

    Source:

    E.Coli

    Purity:

    >95%

    Other names:

    FGF21

    Species:

    Mouse

    • INTRODUCTION

      FGF-21, a polypeptide with 210 amino acid residues produced mostly from the liver tissue. Mouse FGF- 21 shares 75% identity as human FGF-21. Recent animal studies indicate it possesses potent beneficial effects on glucose and lipid metabolism and insulin sensitivity. Increasing data shows FGF-21 can significantly stimulate glucose uptake in mature adipocytes. And the lowered LDL-cholesterol and increased HDL-cholesterol can also be observed. FGF-21 exerts its bioactivity through interaction with membrane bound FGF receptors (FGFRs) which requires β-Klotho as a co-factor to bind and activate FGFR signaling. The activation of FGF-21 can induce the stimulation of diverse downstream pathways medicated by MAPK,FRS-2, SHP-2, PI3K, raf, stat and other signaling molecules. In sum, FGF-21 induces a variety of significant beneficial metabolic changes without apparent adverse effects which makes this factor a hot candidate to treat some metabolic diseases.

    • DATA SHEET

    • DESCRIPTION

      Total 184 AA Mw: 20kDa (calculated).

      N-terminal His- tag removed, 2 extra AA left (highlighted).

    • AMINO ACID SEQUENCE

      GAAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

    • STORAGE

      Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.Avoid repeated freezing /thawing cycles.

    • RECONSTITUTION

      Add sterile deionized water to prepare a working stock solution of approximately 1 mg/mLand let the lyophilized pellet dissolve completely.

    • QUALITY CONTROL TEST

      BCA to determine quantity of the protein.

      SDS PAGE to determine purity of the protein.

    • FORMULATION

      Lyophilized in 1 mg/mL in PBS.

    • APPLICATION

      Cell culture, animal studies, ELISA and Western blotting.

    • SDS-PAGE Gel

      See image

    • PUBLICATIONS CITING OUR PRODUCT:

      • Lin Z, Tian H, et al. Adiponectin mediates the metabolic effects of FGF21 on glucose homeostasis and insulin sensitivity in mice. Cell Metab. 2013 May 7;17(5):779-89
      • So WY, Cheng Q, et al. High Glucose Represses β-Klotho Expression and Impairs Fibroblast Growth Factor 21 Action in Mouse Pancreatic Islets: Involvement of Peroxisome Proliferator-Activated Receptor γ Signaling. Diabetes. 2013 Nov;62(11):3751-9.
      • Li H, Gao Z, et al. Sodium butyrate stimulates expression of fibroblast growth factor 21 in liver by inhibition of histone deacetylase 3. Diabetes. 2012 Apr;61(4):797-806.
      • Ge X, Chen C, et al. Fibroblast growth factor 21 induces glucose transporter-1 expression through activation of the serum response factor/Ets-like protein-1 in adipocytes. J Biol Chem. 2011 Oct 7;286(40):34533-41.
    • ENDOTOXIN LEVEL

      <0.2 EU/ug.

    • GLUCOSE UPTAKE ASSAY

      See image 2

    $360.00Price

    ©2019 by ImmunoDiagnostics Limited.