• Recombinant Mouse Fibroblast Growth Factor-21 (mFGF-21) without Tag

    SKU: 42189

    Type:

    Recombinant

    Cat. No.:

    42189

    Tag:

    None (his-tag removed)

    Size:

    100 µg

    Source:

    E.Coli

    Purity:

    >95%

    Other names:

    FGF21

    Species:

    Mouse

    • INTRODUCTION

      FGF21 is a metabolic hormone mainly produced in liver. It regulates glucose and lipid metabolism through pleiotropic actions in multiple tissues, and protects against metabolic damages under various stresses.
      In humans, high circulating FGF21 levels are found in obesity and multiple cardiometabolic disorders, including metabolic syndrome, type 2 diabetes, non-alcoholic fatty liver disease and coronary artery disease. Serum FGF21 is a potential biomarker for the early detection and risk prediction of these diseases.

       

    • DATA SHEET

    • DESCRIPTION

      Total 184 AA Mw: 20kDa (calculated). N-terminal His-tag removed,2 extra AA left (highlighted).

    • AMINO ACID SEQUENCE

      GAAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

       

    • STORAGE

      Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.Avoid repeated freezing /thawing cycles.

    • RECONSTITUTION

      Add sterile deionized water to prepare a working stock solution of approximately 1 mg/mLand let the lyophilized pellet dissolve completely.

    • QUALITY CONTROL TEST

      BCA to determine quantity of the protein.

      SDS PAGE to determine purity of the protein.

    • FORMULATION

      Lyophilized in 1 mg/mL in PBS.

    • APPLICATION

      Cell culture, animal studies, ELISA and Western blotting.

    • SDS-PAGE Gel

      See image

    • PUBLICATIONS CITING OUR PRODUCT:

      So, W. Y., et al. Cell Death Dis. 2015; 6:e1707. 
      Gong Q, Hu Z, Zhang F, et al. Hepatology. 2016; 64(2): 425-438.
      So, Wing Yan, et al. Diabetes. 2013; 62(11):3751-9

       

    • ENDOTOXIN LEVEL

      <0.2 EU/ug.

    • GLUCOSE UPTAKE ASSAY

      See image

    $360.00Price

    ©2019 by ImmunoDiagnostics Limited.