mMUP-1 (Recombinant Mouse Major urinary protein-1)

SKU: 42150

Type:

Recombinant

Cat. No.:

42150

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

Mup7, Up-1, Ltn-1, Mup-1,

Mup-a, Mup10, Lvtn-1

Species:

Mouse

  • INTRODUCTION

    Major urinary protein 1 (Mup1), also known as Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10 and Lvtn-1, is a low molecular weight secreted protein produced predominantly from the liver. Structurally it belongs to the lipocalin family, which carries small hydrophobic ligands such as pheromones. Mup1 is an important player in regulating energy expenditure and metabolism in mice, and its deficiency might contribute to the metabolic dysregulation in obese/diabetic mice.

     

  • DATA SHEET

  • DESCRIPTION

    Total 190 AA. Mw: 22 KDa (calculated). N-terminal His-tag and TEV cleavage site,

    28 extra AA (highlighted).

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAMGSEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRL

    FLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGE

    TFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in PBS.

  • APPLICATION

    ELISA and Western Blotting.

  • SDS-PAGE Gel

    See Image

  • ENDOTOXIN LEVEL

    <0.01EU per 1µg of protein by LAL method.

$200.00Price

©2019 by ImmunoDiagnostics Limited.