SmD1

Human Small Nuclear Ribonucleoprotein Sm D1

 

Origin:

Recombinant

Cat. No.:

41540

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>90%

Other Names:

SmD1, snRNPD1

Species:

Human

  • INTRODUCTION

    Small nuclear ribonucleoprotein complexes (abbreviated as U-snRNP) are essential for splicing of precursor mRNA molecules. Seven different Sm proteins aggregate into a heteroheptameric protein core, including small nuclear ribonucleoprotein Sm D1 (SmD1 or snRNPD1). In the blood of patients with systemic lupus erythematosus, antinuclear antibodies are developed with Sm specificity.

     

  • DATA SHEET

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, SmD1 binds with IgG-type human auto-antibodies.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

  • APPLICATIONS

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • FORMULATION

    Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300mM NaCl, 0.4M L-Arginine, PH8.0).

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

     

  • DESCRIPTION

    Expressed in insect Sf9 cells with total 143 AA. Mw: 16.2 KDa (calculated).

    N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeatedfreezing /thawing cycles.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • SDS-PAGE Gel

    Refer to picture 

$998.00Price
Quantity

©2019 by ImmunoDiagnostics Limited.