TGF beta 1/TGFB1 Protein (transforming growth factor beta 1) is a multifunctional cytokine, which is synthesized by almost all cells. TGF beta 1/TGFB1 Protein has a high ability to bind with TGFbRII. The sequence of amino acids in TGFB1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGFB has been only slightly altered, and that both in humans and in animals, its function is similar. TGF beta 1/TGFB1 Protein is secreted as an inactive peptide, forming part of a ‘latent complex’ consisting of a mature TGFB1 dimer non-covalently bound to its latency-associated peptide (LAP) and, via LAP, to latent TGFB-binding proteins (LTBPs). Activated TGF beta 1/TGFB1 Protein binds to ubiquitously expressed cell-surface TGFB1 type I receptors (TGFBRI) and type II receptors (TGFBRII), which are transmembrane serine/threonine kinases. TGF beta 1/TGFB1 Protein regulates cell proliferation, growth, differentiation, and cells movement.

Ala279-Ser390
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Lyophilized powder

50 mM Glycine-HCl, 150 mM NaCl, pH 2.5

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

• 12 months from date of receipt, -20 to -70 °C as supplied.
• 6 months, -20 to -70 °C under sterile conditions after reconstitution.
• 1 week, 2 to 8 °C under sterile conditions after reconstitution.

Note: Please avoid repeated freeze-thaw cycles