BCOADC-E2 (Human Branched Chain 2-oxo-acid Dehydrogenase Complex E2)
  • BCOADC-E2 (Human Branched Chain 2-oxo-acid Dehydrogenase Complex E2)

    SKU: 41A062

    ★ Download Datasheet PDF ★

     

     

    Origin:

    Recombinant

    Cat. No.:

    41A062

    Tag:

    N-terminal 6xHis

    Size:

    0.1 mg

    Source:

    Spodopterafrugiperda Sf9

    Purity:

    >90%

    Other names:

    BCOADC-E2, BCKAD-E2,BCATE2

    Species:

    Human

    • INTRODUCTION

      BCOADC-E2 is the central E2 component of branched chain 2-oxo acid dehydrogenase complex (BCOADC), which is a mitochondrial multienzyme complex involved in the maintenance of the cellular redox state. 

       

    • DATA SHEET

    • DESCRIPTION

      Expressed in insect Sf9 cells with a total 446 AA.

      Mw: 49.5 KDa(calculated).

      N-terminal 6xHis-tag and TEV cleavage site, extra 25 AA (highlighted).

      Recombinant antigen for research use or manufacturing only.

    • AMINO ACID SEQUENCE

      MSYYHHHHHHDYDIPTTENLYFQGAGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK

    • STORAGE

      Store at –80°C.  Avoid repeated freezing/thawing cycles.

    • QUALITY CONTROL TEST

      BCA to determine quantity of the protein.

      SDS PAGE to determine purity of the protein.

    • FORMULATION

      Liquid in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, Protease inhibitor, pH8.0).

    • APPLICATION

      Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

    • SDS-PAGE Gel

      See image

    • IMMUNOLOGICAL FUNCTION

      As an autoantigen, BCOADC-E2 binds with IgG-type human auto-antibodies.

    ©2019 by ImmunoDiagnostics Limited.