Fms-like tyrosine kinase 3 (FLT-3) is a cytokine receptor expressed on the surface of bone-marrow progenitor of hematopoietic cells. FLT-3 ligands (FLT-3L) are produced by peripheral blood mononuclear cells, and found in various human body fluids. FLT-3L is a cytokine that promotes the survival, proliferation, and differentiation of hematopoietic progenitors in synergy with other growth factors, such as stem cell factor. FLT-3 signal is involved in the regulation of vessel formation as well as B cell differentiation, suggesting that FLT-3 signal contributes to the pathogenesis of vascular abnormalities and immune dysregulation in rheumatic diseases. The FLT-3L plays a role in complex cytokine interactions in the process of proliferation and differentiation of various hematologic periods while it is a router in early cell interactions.

Thr27-Pro185
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

Lyophilized powder

PBS, pH 7.4

Reconstitute at less than 0.2 mg/ml according to the size in ultrapure water after rapid centrifugation.

• 12 months from date of receipt, -20 to -70 °C as supplied.
• 6 months, -20 to -70 °C under sterile conditions after reconstitution.
• 1 week, 2 to 8 °C under sterile conditions after reconstitution.

Note: Please avoid repeated freeze-thaw cycles