©2019 by ImmunoDiagnostics Limited.

Human Asprosin

SKU: 41460

Origin:

Recombinant

Cat. No.:

41460

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other Names:

 

Species:

Human

  • INTRODUCTION

    Asprosin is a fasting-induced glucogenic protein that responds to low dietary glucose by stimulating hepatic glucose release. It is secreted by white adipose tissue and circulates in the plasma at nanomolar levels. Asprosin-induced hepatic glucose production is mediated by G protein-cAMP-protein kinase A pathway and is shown to be pathologically related with human and mouse insulin resistance.

  • DATA SHEET

  • DESCRIPTION

    Expressed in E.coli with total 176 AA. Mw: 20.0 KDa (calculated).

    N-terminal 6xHis-tag and EK cleavage site, 36 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSSTNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolves completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 8.0.

  • APPLICATION

    ELISA and Western Blotting.

  • SDS-PAGE Gel

    See image

  • ENDOTOXIN LEVEL

    <0.2 EU/ug

$260.00Price