©2019 by ImmunoDiagnostics Limited.

Human Galectin-3

SKU: 41690

Origin:

Recombinant

Cat. No.:

41690

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other Names:

Gal-3,MAC-2, CBP 35, lectin L-29, AGER 3

Species:

Mouse

  • INTRODUCTION

    Galectin-3 is expressed by a wide range of cell types including activated T cells, tumor cells, macrophages, osteoclasts, fibroblasts, and epithelial cells.  

    Galectin-3 has specific binding affinity for beta-galactoside sugar moieties and has functional roles during development, innate immunity, cell apoptosis, and tumor metastasis.  Galectin-3 is associated with cancer, heart failure, stroke, and inflammation.

      

     

  • DATA SHEET

  • DESCRIPTION

    Expressed in E.coli with total 293AA. Mw: 31.1 kDa (calculated). 
    N-terminal 6xHis-tag, EK recognition site and TEV cleavage site, 44 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSENLY FQGAADNFSL HDALSGSGNPNPQGWPGAWG NQPAGAGGYPGASYPGAYPG QAPPGAYPGQ APPGAYPGAP GAYPGAPAPGVYPGPPSGPG AYPSSGQPSA TGAYPATGPYGAPAGPLIVPYNLPLPGGVV PRMLITILGTVKPNANRIAL DFQRGNDVAFHFNPRFNENN RRVIVCNTKL DNNWGREERQSVFPFESGKPFKIQVLVEPD HFKVAVNDAHLLQYNHRVKK LNEISKLGIS GDIDLTSASY TMI

     

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized at 1 mg/mL in PBS.

  • APPLICATION

    Standard ELISA test, Western Blot.

  • SDS-PAGE Gel

    See image

  • ENDOTOXIN LEVEL

    <0.01 EU per 1 μg of the protein by the LAL method.

$330.00Price