hIL-33 (Human Interleukin-33)

hIL-33 (Human Interleukin-33)

SKU: 42750

★ Download Datasheet PDF ★

 

 

Origin:

Recombinant

Cat. No.:

42750

Tag:

No tag

Size:

0.1 mg

Source:

E.coli

Purity:

>90%

Other names:

IL-33

Species:

Human

  • INTRODUCTION

    IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. The N-terminal portion of full length IL-33 contains a predicted bipartite nuclear localization sequence and a homeodomain-like helix-turn-helix DNA binding domain. The C-terminal fragment, corresponding to mature IL-33, binds and triggers signaling through mast cell IL-1 R4/ST2L, a longtime orphan receptor involved in the augmentation of Th2 cell responses. A ternary signaling complex is formed by the subsequent association of IL-33 and ST2L with IL-1R AcP. Stimulation of Th2 polarized lymphocytes with mature IL-33 in vitro induces IL-5 and IL-13 secretion. In vivo administration of mature IL-33 promotes increased production of IL-5, IL-13, IgE, and IgA, as well as splenomegaly and inflammatory infiltration of mucosal tissues.

  • DATA SHEET

  • DESCRIPTION

    Expressed in E.coli with total 167 AA. Mw: 18.81 KDa (calculated).

    No tag, but with 2 extra AA at N-terminal (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    GASITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMETLMETVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMETHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolves completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 7.0.

  • APPLICATION

    ELISA and Western Blotting.

  • SDS-PAGE Gel

    See image

  • ENDOTOXIN LEVEL

    <0.2 EU per 1 μg of the protein by the LAL method.

     

©2019 by ImmunoDiagnostics Limited.