Ku70/80 (Human X-ray repair cross-complementing  protein 5/6)

Ku70/80 (Human X-ray repair cross-complementing protein 5/6)

★ Download Datasheet PDF ★

 

Origin:

Recombinant

Cat. No.:

41A180

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>90%

Other Names:

Ku70/80, Ku70 80, Ku

Species:

Human

  • INTRODUCTION

    The Ku autoantigen is a heterodimer of 70kDa (p70) and 80kDa (p80) proteins. Anti-Ku antibodies are reported in various connective tissue diseases and the Ku complex can be responsible for a very strong autoimmune answer in autoimmune disease.

     

  • DATA SHEET

  • DESCRIPTION

    Heterodimer expressed in insect Sf9 cells containing a 633 AA (Mw: 72.8 KDa) Ku70 and a 743 AA (Mw: 84.1 KDa) Ku80.

    Ku70 has N-terminal 6xHis-tag and TEV cleavage site with 25 extra AA (highlighted), while Ku80 has C-terminal Flag-tag with 21 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    Ku70:

    MSYYHHHHHHDYDIPTTENLYFQGASGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD

    Ku80: MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMISYYDYKDDDDK

  • STORAGE

    Store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Liquid in storage buffer (20mM Tris, 300-500mM NaCl, 10% Glycerol, pH8.0).

  • APPLICATION

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • SDS-PAGE Gel

    See image

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, Ku70/80 binds with IgG-type human auto-antibodies.

$265.00Price

©2019 by ImmunoDiagnostics Limited.