LC1 (Human Formiminotransferase Cyclodeaminase)

SKU: 41A052

Origin:

Recombinant

Cat. No.:

41A052

Concentration:

0.42 mg/mL

Size:

0.1 mg

Source:

Spodopterafrugiperda Sf9

Purity:

>90%

Other Names:

LC1, FTCD

Species:

Human

  • INTRODUCTION

    LC1is an enzyme which catalyzes the conversion of formiminoglutamateandtetrahydrofolateintoformiminotetrahydrofolateandglutamate. As a bifunctional enzyme of tetrahydrofolate synthesis, it is the target antigen of anti-LC1 (liver cytosol antigen type 1) autoantibodies. Presence of LC1 autoantibodies is a marker for type 2 autoimmune hepatitis.

     

  • DATA SHEET

  • DESCRIPTION

    Expressed in insect Sf9 cells with total 565 AA.Mw:58.53KDa(calculated).

    N-terminal 6xHis-tag and TEV cleavage site, extra 25 AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGASQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

     

  • STORAGE

    Store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Liquid at 0.42 mg/mL in storage buffer (20mM Tris, 300mM NaCl, 10% Glycerol, pH8.0).

  • APPLICATION

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • SDS-PAGE Gel

    See image

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, LC1 binds with IgG-type human auto-antibodies.

$316.00Price

©2019 by ImmunoDiagnostics Limited.