OGDC-E2 (Human 2-oxoglutarate dehydrogenase complex E2)

SKU: 41A072

Origin:

Recombinant

Cat. No.:

41A072

Concentration:

0.13 mg/mL

Size:

0.1 mg

Source:

Spodopterafrugiperda Sf9

Purity:

>90%

Other Names:

OGDC-E2, DLST

Species:

Human

  • INTRODUCTION

    OGDC-E2 is the central E2 component of 2-oxoglutarate dehydrogenase complex (OGDC), which is a mitochondrial multienzyme complex involved in the maintenance of the cellular redox state.

    Patients with primary biliary cirrhosis show autoantibodies against the E2 component of 2-oxoglutarate dehydrogenase complex.

     

  • DATA SHEET

  • DESCRIPTION

    Expressed in insect Sf9 cells with total 411 AA.Mw:45.98KDa(calculated).

    N-terminal 6xHis-tag and TEV cleavage site, extra 25 AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGADDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

  • STORAGE

    Store at –80°C.  Avoid repeated freezing/thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Liquid at 0.13 mg/mL instorage buffer(20mM Tris, 300mM NaCl, 10% Glycerol, pH8.0).

  • APPLICATION

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • SDS-PAGE Gel

    See image

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, OGDC-E2 binds with IgG-type human auto-antibodies.

$265.00Price

©2019 by ImmunoDiagnostics Limited.