hFGF-21, Tagless (Human Fibroblast Growth Factor 21 without Tag)

hFGF-21, Tagless (Human Fibroblast Growth Factor 21 without Tag)

SKU: 41189

★ Download Datasheet PDF ★

 

 

Type:

Recombinant

Cat. No.:

41189-01

Tag:

None (his-tag removed)

Size:

0.1 mg

Source:

E.Coli

Purity:

>90%

Other names:

FGF21

Species:

Human

  • INTRODUCTION

    FGF-21, a polypeptide with 210 amino acid residues produced mostly from the liver tissue. Mouse FGF- 21 shares 75% identity as human FGF-21. Recent animal studies indicate it possesses potent beneficial effects on glucose and lipid metabolism and insulin sensitivity. Increasing data shows FGF-21 can significantly stimulate glucose uptake in mature adipocytes. And the lowered LDL-cholesterol and increased HDL-cholesterol can also be observed. FGF-21 exerts its bioactivity through interaction with membrane bound FGF receptors (FGFRs) which requires β-Klotho as a co-factor to bind and activate FGFR signaling. The activation of FGF-21 can induce the stimulation of diverse downstream pathways medicated by MAPK,FRS-2, SHP-2, PI3K, raf, stat and other signaling molecules. In sum, FGF-21 induces a variety of significant beneficial metabolic changes without apparent adverse effects which makes this factor a hot candidate to treat some metabolic diseases.

  • DATA SHEET

  • DESCRIPTION

    Total 183AA Mw: 19.5kDa (calculated).

    N-terminal His-tag removed, 2 extra AA left (highlighted).

  • AMINO ACID SEQUENCE

    GAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.Avoid repeated freezing /thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and letthe lyophilized pellet dissolve completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in 1 mg/mL in PBS.

  • APPLICATION

    ELISA and Western blotting.

  • SDS-PAGE Gel

    See pictures.

$360.00Price

©2019 by ImmunoDiagnostics Limited.