Recombinant Human Fibroblast Growth Factor-21 without Tag

SKU: 41189

Type:

Recombinant

Cat. No.:

41189-01

Tag:

None (his-tag removed)

Size:

0.1 mg

Source:

E.Coli

Purity:

>90%

Other names:

FGF21

Species:

Human

  • INTRODUCTION

    FGF21 is a metabolic hormone mainly produced in liver. It regulates glucose and lipid metabolism through pleiotropic actions in multiple tissues, and protects against metabolic damages under various stresses.
    In humans, high circulating FGF21 levels are found in obesity and multiple cardiometabolic disorders, including metabolic syndrome, type 2 diabetes, non-alcoholic fatty liver disease and coronary artery disease. Serum FGF21 is a potential biomarker for the early detection and risk prediction of these diseases.

     

  • DATA SHEET

  • DESCRIPTION

    Total 183AA Mw: 19.5kDa (calculated). N-terminal His-tag removed, 2 extra AA left (highlighted).

  • AMINO ACID SEQUENCE

    GAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.Avoid repeated freezing /thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and letthe lyophilized pellet dissolve completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in 1 mg/mL in PBS.

  • APPLICATION

    ELISA and Western blotting.

  • SDS-PAGE Gel

    See pictures.

$360.00Price

©2019 by ImmunoDiagnostics Limited.