hLCN2/NGAL (Human Lipocalin 2)

hLCN2/NGAL (Human Lipocalin 2)

SKU: 41050

★ Download Datasheet PDF ★

 

 

Type:

Recombinant

Cat. No.:

41050

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>90%

Other names:

24p3; MSFI; NGAL

Species:

Human

  • INTRODUCTION

    Lipocalin-2(LCN2), also known as neutrophil gelatinase-associated lipocalin (NGAL), 24p3, siderocalin, or neutrophil lipocalin (NL), is a secretory glycoprotein which is expressed in liver, lung, kidney, adipocytes, activated neutrophils, and macrophages. LCN2 appears to be upregulated in the case of information and infection conditions. Several reports suggest that LCN2 may represent a sensitive biomarker for various renal injuries and somehow may be involved in the pathophysiological process of some chronic renal diseases. LCN2 is also high expressed under high fat diet and obese background especially in adipose tissue and is closely associated with obesity, insulin resistance, and hyperglycemia in humans.

  • DATA SHEET

  • DESCRIPTION

    Total 206AA. Mw: 23.9kDa (calculated).

    N-terminal His-tag and TEV cleavage site, 28 extra AA (highlighted).

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAMGSQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

    Avoid repeated freezing /thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and letthe lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in 1 mg/mL in PBS.

  • APPLICATION

    ELISA and Western blotting.

  • SDS-PAGE Gel

    See pictures.

  • PUBLICATIONS CITING OUR PRODUCT

     Ye, Dewei, et al. J Hepatol. 2017; 66(3):669.
     Ye, Dewei, et al. J Hepatol. 2016; 65(5):988-997.

$200.00Price

©2019 by ImmunoDiagnostics Limited.