©2019 by ImmunoDiagnostics Limited.

hLCN-2 (Recombinant Human Lipocalin 2)

SKU: 41050

Type:

Recombinant

Cat. No.:

41050

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>90%

Other names:

24p3; MSFI; NGAL; LCN2

Species:

Human

  • INTRODUCTION

    Lipocalin-2, also known as neutrophil gelatinase-associated lipocalin (NGAL), 24p3, siderocalin, or neutrophil lipocalin (NL), is a secretory glycoprotein  expressed in liver, lung, kidney, adipocytes, activated neutrophils and macrophages.
    Lipocalin-2 is upregulated under various inflammation and infection conditions and can be served as a sensitive biomarker for various renal injuries. Serum levels of lipocalin-2 are positively correlated with obesity, insulin resistance, hyperglycemia, coronary heart disease and fatty liver disease in humans.
     

     

     

  • DATA SHEET

  • DESCRIPTION

    Total 206AA. Mw: 23.9kDa (calculated). N-terminal His-tag and TEV cleavage site,28 extra AA (highlighted).

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAMGSQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

  • STORAGE

    Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

    Avoid repeated freezing /thawing cycles.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and letthe lyophilized pellet dissolve completely.

     

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilized in 1 mg/mL in PBS.

  • APPLICATION

    ELISA and Western blotting.

  • SDS-PAGE Gel

    See pictures.

  • PUBLICATIONS CITING OUR PRODUCT

     Ye, Dewei, et al. J Hepatol. 2017; 66(3):669.
     Ye, Dewei, et al. J Hepatol. 2016; 65(5):988-997.

$200.00Price