©2019 by ImmunoDiagnostics Limited.

Recombinant Human Tumor necrosis factor alpha, soluble form (TNF-α)

SKU: 41080

Origin:

Recombinant

Cat. No.:

4141080

Tag:

His tag on N terminal

Size:

0.1 mg

Source:

E.Coli

Purity:

>90%

Other Names:

TNF-α

Species:

Human

  • INTRODUCTION

    TNF-α is a cytokine produced by monocytes and macrophages.  It consists of a 35 amino acid (aa) cytoplasmic domain, a 21 aa transmembrane segment, and a 177 aa extracellular domain.  Cleavage of membrane bound TNF-α by TACE/ADAM17 releases a 55 KDa soluble trimer. TNF-α functions as a modulator of immune response and plays a role in the pathogenesis of many disease states.

  • DATA SHEET

  • AMINO ACID SEQUENCE

    MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVA

  • STORAGE

    Store lyophilized protein at –20°C.  Aliquot reconstituted protein and store at –80°C for long term storage.

  • RECONSTITUTION

    Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • FORMULATION

    Lyophilised in 1 mg/mL in PBS.

  • APPLICATION

    ELISA and Western blotting.

  • SDS-PAGE Gel

    See image

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, OGDC-E2 binds with IgG-type human auto-antibodies.

$265.00Price