©2019 by ImmunoDiagnostics Limited.

  • Ro/SS-A (60 kDa)

    Origin:

    Recombinant

    Cat. No.:

    41580

    Tag:

    N-terminal 6xHis

    Size:

    0.1 mg

    Source:

    Spodoptera frugiperda Sf9

    Purity:

    >80%

    Other Names:

    TROVE2, SSA/Ro60, Ro60

    Species:

    Human

    • INTRODUCTION

      Ro/SSA ribonucleoproteins are involved in RNA quality control and cellular stress response to UV irradiation, and comprise of a single polypeptide and four small RNA molecules including the 60 kDa Ro protein. Ro/SSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. 

       

    • DATA SHEET

    • IMMUNOLOGICAL FUNCTION

      As an autoantigen, SSA/Ro60 binds with IgG-type human auto-antibodies.

    • AMINO ACID SEQUENCE

      MSYYHHHHHHDYDIPTTENLYFQGAEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI

    • APPLICATIONS

      Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

    • FORMULATION

      Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

    • RECONSTITUTION

      Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

    • DESCRIPTION

      Expressed in insect Sf9 cells with total 562 AA. Mw: 63.6 KDa (calculated).

      N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

      Recombinant antigen for research use or manufacturing only.

    • STORAGE

      Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeatedfreezing /thawing cycles.

    • QUALITY CONTROL TEST

      BCA to determine quantity of the protein.

      SDS PAGE to determine purity of the protein.

    • SDS-PAGE Gel

      Refer to picture 

    $1,208.00Price
    Quantity