SSA/Ro60 (Human TROVE domain family member 2)

SSA/Ro60 (Human TROVE domain family member 2)

SKU: 41580

★ Download Datasheet PDF ★

 

 

Origin:

Recombinant

Cat. No.:

41580

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>90%

Other Names:

TROVE2, SSA/Ro60, Ro60

Species:

Human

  • INTRODUCTION

    Ro/SSA ribonucleoproteins are involved in RNA quality control and cellular stress response to UV irradiation, and comprise of a single polypeptide and four small RNA molecules including the 60 kDa Ro protein. Ro/SSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.

     

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, SSA/Ro60 binds with IgG-type human auto-antibodies.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGAEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI

  • APPLICATIONS

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • FORMULATION

    Liquid in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, Protease inhibitor, pH8.0).

  • DESCRIPTION

    Expressed in insect Sf9 cells with total 562 AA.

    Mw: 63.6 KDa (calculated).

    N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • STORAGE

    Store at –80°C. Avoid repeated freezing /thawing cycles.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

$248.00Price

For bulk order (QTY: 5 or more), please contact us for quote

Featured Products