SARS-CoV-2 Open Reading Frame-8 (ORF8), Truncated

SARS-CoV-2 Open Reading Frame-8 (ORF8), Truncated

SKU: 41A258

★ Download Datasheet PDF ★

 

 

Type:                       

Recombinant         

Cat. No.:          

41A258

Tag:

None

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other names:

ORF8

Endotoxin

< 5 EU/mg

 

 

  • DESCRIPTION

    Expressed in E. coli with total 96AA. MW: 17.1 kDa.

    Truncated ORF8 (27aa-122aa) (excluding signal peptide and a-helix region).

    Includes rTEV cleavage site (ENLYFQG).

  • INTRODUCTION

    The genome of SARS-CoV-2 encodes accessory genes that differ significantly within coronaviruses and contribute to the virus pathogenicity. Among accessory genes, open reading frame 8 (ORF8) stands out by being highly variable and showing structural changes suspected to be related with the virus ability to spread. SARS-CoV-2 ORF8 is a 122 amino acid protein with less than 20% sequence identity to SARS-CoV ORF8. It has an N-terminal signal sequence for the protein secretion, followed by an alpha-helix domain and a beta-sheet containing six strands. The recombinant ORF8 generated by Immunodiagnostics does not contain the a-helix region to increase the solubility.

  • AMINO ACID SEQUENCE

    QHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELC

    VDEAGSKSPIQYIDIGNYTVSCLP-FTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

  • FORMULATION

    Liquid containing ORF8 (2.0 mg/ml) in 50mM Tris, 300mM NaCl, 10% Glycerol, pH8.0.

  • STORAGE

    Store protein at –20°C or –80°C. Avoid repeated freezing / thawing cycles.

  • APPLICATIONS

    ELISA and Western blotting.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS-PAGE to determine purity of the protein.

$243.00Price

For bulk order (QTY: 5 or more), please contact us for quote