SmD3 (Human small nuclear ribonucleoprotein Sm D3)

SmD3 (Human small nuclear ribonucleoprotein Sm D3)

★ Download Datasheet PDF ★

 

 

Origin:

Recombinant

Cat. No.:

41550

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>90%

Other Names:

SmD3, snRNPD3

Species:

Human

 

 

  • INTRODUCTION

    Small nuclear ribonucleoprotein complexes (abbreviated as U-snRNP) are essential for splicing of precursor mRNA molecules. Seven different Sm proteins aggregate into a heteroheptameric protein core, including small nuclear ribonucleoprotein Sm D3 (SmD3 or snRNPD3).

    In the blood of patients with systemic lupus erythematosus, antinuclear antibodies are developed with Sm specificity.

     

  • DATA SHEET

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, SmD3 binds with IgG-type human auto-antibodies.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGASIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

  • APPLICATIONS

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • FORMULATION

    Liquid in storage buffer(50mM Tris, 150mM NaCl, 400mM L-Arginine, 2mM Reduced GSH, 0.2mM Oxidized GSSG, Protease inhibitor, pH 7.4).

  • DESCRIPTION

    Expressed in insect Sf9 cells with total 150 AA.

    Mw: 16.9 KDa (calculated).

    N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only.

  • STORAGE

    Store at –80°C. Avoid repeated freezing/thawing cycles.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • SDS-PAGE Gel

    Refer to picture 

Quantity

©2019 by ImmunoDiagnostics Limited.