SmB/B' (Human Small Ribonucleoprotein Associated Protein B B')

SmB/B' (Human Small Ribonucleoprotein Associated Protein B B')

★ Download Datasheet PDF ★

 

Origin:

Recombinant

Cat. No.:

41530

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>90%

Other Names:

SmB/B’, snRNPB/B’, SmB

Species:

Human

 

  • INTRODUCTION

    Small nuclear ribonucleoprotein complexes (abbreviated as U-snRNP) are essential for splicing of precursor mRNA molecules and snRNPB is one of several nuclear proteins which are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). Autoantibodies from patients with systemic lupus erythematosus (SLE) recognize epitopes on snRNPB/B’.

  • DATA SHEET

  • IMMUNOLOGICAL FUNCTION

    As an autoantigen, SmB/B’ binds with IgG-type human auto-antibodies.

  • AMINO ACID SEQUENCE

    MSYYHHHHHHDYDIPTTENLYFQGATVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP.

  • APPLICATIONS

    Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

  • FORMULATION

    Liquid in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, Protease inhibitor, pH8.0).

  • DESCRIPTION

    Expressed in insect Sf9 cells with total 264 AA.

    Mw: 27.6 KDa (calculated).

    N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

    Recombinant antigen for research use or manufacturing only

  • STORAGE

    Store at –80°C. Avoid repeated freezing /thawing cycles.

  • QUALITY CONTROL TEST

    BCA to determine quantity of the protein.

    SDS PAGE to determine purity of the protein.

  • SDS-PAGE Gel

    Refer to picture 

Quantity

©2019 by ImmunoDiagnostics Limited.